PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun004933
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NF-YB
Protein Properties Length: 205aa    MW: 23097.8 Da    PI: 5.8105
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Vun#S45823920PU_refUnigeneView CDS
PUT-167a-Vigna_unguiculata-22751PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB79.44.8e-2560143386
      NF-YB   3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 
                ++d+ lP a +++i+k++lP + ++++da++++ ec +efi +v+se+++ c++e+r+ti+++ +l al+ lGf dy+e++ + 
  Vun004933  60 KEDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLVSSESNEVCNKEERRTIAPEHVLKALGVLGFGDYIEEVYAA 143
                6899***************************************************************************98654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.8E-3957189IPR009072Histone-fold
SuperFamilySSF471136.54E-3661191IPR009072Histone-fold
PfamPF008083.5E-2263128IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
XIHRIEKQHH HHTTPHLVFI NMGLSASASA MSTFFPSSXQ LTHRPLFIRM EPMDIVGKAK  60
EDASLPKATM TKIIKEMLPP DVRVARDAQD LLIECCVEFI NLVSSESNEV CNKEERRTIA  120
PEHVLKALGV LGFGDYIEEV YAAYEQHKLE TMQDSLKGAK WSNRAEMTEE EALAEQQRMF  180
AEARARMNGG AITPKQPDAD QSLES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B8e-356118412133Transcription Regulator NC2 beta chain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014494002.11e-112PREDICTED: protein Dr1 homolog
SwissprotP495922e-91NC2B_ARATH; Protein Dr1 homolog
TrEMBLA0A0L9UB341e-112A0A0L9UB34_PHAAN; Uncharacterized protein
STRINGGLYMA05G07750.11e-102(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.21e-92nuclear factor Y, subunit B13